PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM03G32350.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 344aa    MW: 37719.5 Da    PI: 5.3551
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM03G32350.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.94.1e-092522862155
                      HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS
         Homeobox  21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 
                      + +yps+ e+  LA+++gL+++q+ +WF N+R ++
  OGLUM03G32350.1 252 RWPYPSEMEKIALAESTGLEQKQINNWFINQRKRH 286
                      669*****************************885 PP

2ELK33.21.1e-11207227222
              ELK   2 LKhqLlrKYsgyLgsLkqEFs 22 
                      LK++LlrKYsgyLg+L++E+s
  OGLUM03G32350.1 207 LKRHLLRKYSGYLGGLRKELS 227
                      9******************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012561.9E-24104155IPR005541KNOX2
PfamPF037913.7E-19110153IPR005541KNOX2
SMARTSM011882100113133IPR005539ELK domain
SMARTSM011885.4E-6206227IPR005539ELK domain
PROSITE profilePS5121310.109206226IPR005539ELK domain
PfamPF037898.2E-8207227IPR005539ELK domain
PROSITE profilePS5007113.054226289IPR001356Homeobox domain
SuperFamilySSF466891.03E-18227298IPR009057Homeodomain-like
SMARTSM003892.1E-12228293IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.607.2E-27231292IPR009057Homeodomain-like
CDDcd000869.78E-12238289No hitNo description
PfamPF059204.2E-16246285IPR008422Homeobox KN domain
PROSITE patternPS000270264287IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 344 aa     Download sequence    Send to blast
MEELEGHRGA GRLPPPPPLL PFPKVSVQVY TVPSSSTAAS AAAAGGARQA VAPATRDGGG  60
RAAGVLDDPV KARIVGCPAE AAEEIAAAAR VREARQRAAA AASRMPPAPE DPELDQFMED  120
YCKLLVECKE ELSRPLQEAE EFLRTVESEL NSINSGPPLT ALISESKAGL DSSDDDEHED  180
GSGMEMMEAA EDEDLGIIDP RSDDKALKRH LLRKYSGYLG GLRKELSKKR KKGKLPKEAR  240
QKLLTWWELH YRWPYPSEME KIALAESTGL EQKQINNWFI NQRKRHWKPT EEMQFAVMEA  300
YHHQSTDAAA AFYVDVDARL VGATAAAPAA AVYTARPDHG VWRA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1221230LRKELSKKRK
2227231KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB0716640.0AB071664.1 Oryza sativa Indica Group mRNA for transcription factor OSH3, complete cds, cultivar:IR24.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015628822.11e-158PREDICTED: homeobox protein knotted-1-like 7
SwissprotQ948L51e-160KNOS7_ORYSJ; Homeobox protein knotted-1-like 7
TrEMBLA0A0D9ZCJ80.0A0A0D9ZCJ8_9ORYZ; Uncharacterized protein
STRINGBGIOSGA009878-PA1e-166(Oryza sativa Indica Group)
STRINGORGLA03G0296300.11e-166(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP150631819
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G08150.15e-61KNOTTED-like from Arabidopsis thaliana